Merck Anti-IDO1 antibody produced in rabbit
다른 상품 둘러보기
Anti-IDO1 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution, Ab2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... IDO1(3620)
IDO1 (indoleamine 2,3-dioxygenase 1) protein is present in the cytoplasm and exists as a monomer. It is mainly expressed in parenchymal tissues including, lungs, gut and the fetal-maternal unit during pregnancy. In addition, it can be seen in trophoblast, fibroblasts, epithelial and tumor cells, tumor-associated cells, macrophages, dendritic cells and microglial cells in the central nervous system. The gene is mapped to human chromosome 8p11. It is also referred to as INDO (indoleamine-pyrrole 2,3-dioxygenase).
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|