Merck Anti-RUNX2 antibody produced in rabbit
다른 상품 둘러보기
Anti-RUNX2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
LNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPA
UniProt 수납 번호
application(s)
research pathology
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... RUNX2(860)
Runt-related transcription factor 2/acute myeloid leukemia 3 protein (RUNX2, AML-3) belongs to Runt DNA-binding domain transcription factor family. RUNX2 gene is mapped to human chromosome 6p21.1 RUNX2 possesses the Runt domain, nuclear localization signal (NLS), the nuclear matrix targeting signal (NMTS) and a C-terminal VWRPY sequence. It also has two additional domains, one being the N-terminal glutamine-alanine (QA) repeats and the other a C-terminal proline/serine/threonine (PST) rich tract. RUNX2 exists in two isoforms. The isoform 1 is expressed in osteoblasts and the isoform 2 is distributed in mesenchymal condensations and mature chondrocytes.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|