Merck Anti-TPK1 antibody produced in rabbit
다른 상품 둘러보기
Anti-TPK1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
western blot: 0.04-0.4 μg/mL
면역원 서열
HRLHVDTGMEGDWCGLIPVGQPCMQVTTTGLKWNLTNDVLAFGTLVSTSNTYDGSGVVTVETDHPL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TPK1(27010)
TPK1 (thiamine pyrophosphokinase 1) protein is encoded by TPK1 gene localized to human chromosome 7q34-36. The gene comprises of at least nine exons and spans ~420kb. TPK1 enzyme is highly expressed in maternal, placental and fetal tissues. The human TPK1 mRNA is expressed relatively high in kidney, small intestine and testis with lesser expression in brain, liver, placenta and spleen.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|