Merck Anti-MPP3 antibody produced in rabbit
다른 상품 둘러보기
Anti-MPP3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
VCLVDVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMSPACEDTAAPFDEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQGAYSQLKVVL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MPP3(4356)
MPP3 (Membrane protein, palmitoylated 3, MAGUK p55 subfamily member 3) is a cytoplasmic protein belonging to the MAGUK family molecules. It is expressed in various tissues including normal lung cells. MPP3 is composed of a pair of Lin2/Lin7-binding (L27) domains, a PDZ domain, a Src-homology 3 (SH3) domain and a guanylate kinase homologous (GuK) domain. It exhibits high homology with Dlg in Drosophila.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|