상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA018994-100UL | - | Merck HPA018994-100UL Anti-KLK7 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 951,160원 | - | 1,046,276원 |
Anti-KLK7 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 0.04-0.4 μg/mL
면역원 서열
MVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... KLK7(5650)
The gene KLK7 (kallikrein-7) is mapped to human chromosome 19q13.4. It belongs to kallikrein-like gene family. KLKs are subgroup of serine proteases. KLK7 is expressed in skin, central nervous system, kidney, mammary and salivary glands. It is a secreted protein.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.