
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-C21orf59 antibody produced in rabbit
상품 한눈에 보기
토끼 유래의 polyclonal 항체로, C21orf59 단백질을 인식합니다. Rat, human, mouse 시료에 반응하며 immunoblotting 및 immunohistochemistry에 적합합니다. Prestige Antibodies® 제품으로 향상된 검증(orthogonal RNAseq)을 거쳤습니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-C21orf59 antibody produced in rabbit
Anti-C21orf59 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab1
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody product type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species reactivity | Rat, Human, Mouse |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Orthogonal RNAseq (Antibody Enhanced Validation) |
| 기술(technique) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:200–1:500 |
| 면역원 서열 | GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKR |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human [C21orf59 (56683)] |
제품 설명
In Chlamydomonas reinhardtii, C21orf59 is localized exclusively to the flagellar matrix.
It is cytoplasmic in rat trachea ciliated epithelial cells and colocalizes with spindle assembly abnormal protein-6 (SAS6), suggesting a centrosomal localization.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



