Merck Anti-CDH17 antibody produced in rabbit
다른 상품 둘러보기
Anti-CDH17 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
independent
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500
면역원 서열
HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CDH17(1015)
Cadherin-17 is a liver-intestine cadherin protein encoded by the CDH17 gene in humans and belongs to unique member of cadherin superfamily. CDH17 is a non-classical cadherin having seven cadherin domains and a transmembrane domain but lacking the conserved cytoplasmic domain of classical cadherins. Cadherins are cellular adhesion molecules that are crucial for intracellular adhesion. These are considered as potential tumor suppressor genes and any alterations in them may lead to invasion and metastasis of tumor cells. The gene CDH17 is mapped to human chromosome 8q22.1 and contains 18 exons.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|