
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-WRNIP1 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-WRNIP1 rabbit polyclonal antibody는 Prestige Antibodies® 라인 제품으로 인간 WRNIP1 단백질 검출에 적합합니다. Affinity isolated, buffered glycerol 용액 형태이며 immunoblotting 및 immunohistochemistry에 사용 가능합니다. −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA031752-100UL Anti-WRNIP1 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-WRNIP1 antibody produced in rabbit
Anti-WRNIP1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 정보
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Product type | Primary antibody |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Enhanced validation | Independent |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:20–1:50 |
| Immunogen sequence | YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG |
| UniProt accession | Q96S55 |
| Shipping condition | Wet ice |
| Storage temperature | −20°C |
유전자 정보
Human gene: WRNIP1 (56897)
The gene WRNIP1 (Werner helicase-interacting protein 1) is mapped to human chromosome 6p25.2.
The encoded protein belongs to the AAA+ ATPase family and is evolutionarily conserved.
It contains a small Rad18-like zinc finger at the amino terminus and a AAA+ ATPase domain in the center of the protein.
제품 이미지
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



