CacheBy
Merck Anti-WRNIP1 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-WRNIP1 antibody produced in rabbit

상품 한눈에 보기

Merck의 Anti-WRNIP1 rabbit polyclonal antibody는 Prestige Antibodies® 라인 제품으로 인간 WRNIP1 단백질 검출에 적합합니다. Affinity isolated, buffered glycerol 용액 형태이며 immunoblotting 및 immunohistochemistry에 사용 가능합니다. −20°C에서 보관합니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Merck HPA031752-100UL Anti-WRNIP1 antibody produced in rabbit, 100uL pk판매 단위 pk
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-WRNIP1 antibody produced in rabbit

Anti-WRNIP1 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

생물학적 정보

항목 내용
Biological source Rabbit
Quality Level 100
Conjugate Unconjugated
Antibody form Affinity isolated antibody
Product type Primary antibody
Clone Polyclonal
Product line Prestige Antibodies® Powered by Atlas Antibodies
Form Buffered aqueous glycerol solution
Species reactivity Human
Enhanced validation Independent
Techniques Immunoblotting: 0.04–0.4 μg/mL
Immunohistochemistry: 1:20–1:50
Immunogen sequence YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG
UniProt accession Q96S55
Shipping condition Wet ice
Storage temperature −20°C

유전자 정보

Human gene: WRNIP1 (56897)

The gene WRNIP1 (Werner helicase-interacting protein 1) is mapped to human chromosome 6p25.2.
The encoded protein belongs to the AAA+ ATPase family and is evolutionarily conserved.
It contains a small Rad18-like zinc finger at the amino terminus and a AAA+ ATPase domain in the center of the protein.

제품 이미지

Merck Sigma 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.