Anti-PLEKHF2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-FLJ13187, Anti-DNB5, Anti-ZFYVE18, Anti-PHAFIN2, Anti-pleckstrin homology domain containing, family F (with FYVE domain) member 2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500
면역원 서열
VYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKSEWMNHINKCVTDLLSKSGKTPSN
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PLEKHF2(79666)
The gene PLEKHF2 (pleckstrin homology and FYVE domain containing 2) is mapped to human chromosome 8q22. The encoded protein belongs to the Phafin protein family and contains pleckstrin homology (PH) domain and a FYVE (Fab 1, YOTB, Vac 1, and EEA1) domain. It is present in the early endosomes and endoplasmic reticulum.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.