Merck Anti-OGT antibody produced in rabbit
Merck의 Anti-OGT rabbit antibody는 Prestige Antibodies® 라인으로 제작된 고품질 polyclonal 항체입니다. Human, mouse, rat에 반응하며 immunoblotting 및 immunohistochemistry에 적합합니다. −20°C에서 보관하며 independent enhanced validation을 거쳤습니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-OGT antibody produced in rabbit
Anti-OGT antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, ab1
생물학적 정보
- Source: Rabbit
- Clone: Polyclonal
- Conjugation: Unconjugated
- Antibody Type: Primary antibody
- Form: Buffered aqueous glycerol solution
- Product Line: Prestige Antibodies® Powered by Atlas Antibodies
반응 종
Mouse, Human, Rat
포장
Antibody small pack of 25 μL
기술 검증
Independent
자세한 내용은 Antibody Enhanced Validation 참고
사용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunohistochemistry: 1:20–1:50
면역원 서열
LYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWA
UniProt 정보
품질 및 저장
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
유전자 정보
Human OGT (8473)
OGT (O-linked N-acetylglucosamine transferase) gene is mapped to human chromosome Xq13.1. This gene encodes for nucleo cytosolic and mitochondrial isoforms of the enzyme. OGT is highly conserved among Caenorhabditis elegans, rat, and human genomes, sharing over 65% amino acid identity. The gene includes multiple tandem tetratricopeptide repeat sequences and is modified by O-GlcNA (O-linked N-acetylglucosamine), also by tyrosine phosphorylation.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.