Merck Anti-SPA17 antibody produced in rabbit

Anti-SPA17 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

---

생물학적 소스

rabbit

제품 스펙

---

향상된 검증

• orthogonal RNAseq
• recombinant expression
  자세한 내용은 Antibody Enhanced Validation 참고

---

사용 가능한 기술

• Immunoblotting: 0.04–0.4 μg/mL
• Immunofluorescence: 0.25–2 μg/mL
• Immunohistochemistry: 1:1000–1:2500

---

면역원 서열

EQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK

---

UniProt 수납 번호

Q15506

---

Gene Information

human ... SPA17(53340)

Sperm autoantigenic protein 17 (SPA17), also known as SP17, is encoded by the gene mapped to human chromosome 11q24.2. The encoded protein belongs to the family of cancer/testis antigens (CTAs). SPA17 is composed of 151 amino acids and has a molecular mass of 24.5 kDa. It contains an N-terminal cAMP-dependent protein kinase A regulatory IIα (PKA RIIα) subunit-like domain, a central heparin binding domain, and a C-terminal calmodulin binding domain. hSPA17 is specifically expressed in testis and also found in ciliated epithelia of the respiratory airways and reproductive systems of both genders.