Anti-SPA17 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500
면역원 서열
EQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SPA17(53340)
Sperm autoantigenic protein 17(SPA17), also known as SP17, is encoded by the gene mapped to human chromosome 11q24.2. The encoded protein belongs to the family of cancer/testis antigens (CTAs). SPA17 is composed of 151 amino acids and has a molecular mass of 24.5kDa. It contains an N-terminal cAMP-dependent protein kinase A regulatory IIα (PKA RIIα) subunit-like domain, a central heparin binding domain and a C-terminal calmodulin binding domain. hSPA17 is specifically expressed in testis. In addition, it is also found in ciliated epithelia of the respiratory airways and both the male and female reproductive systems.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|