Merck Anti-KIF6 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA038811-100UL | - | Merck HPA038811-100UL Anti-KIF6 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 895,700원 | - | 985,270원 |
다른 상품 둘러보기
Anti-KIF6 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:1000-1:2500
면역원 서열
NEAVLNEEINPRLVIKRLQKEIQELKDELAMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRKVHHCFHHL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... KIF6(221458)
Kinesin family member 6 (KIF6) is a motor protein, encoded by the gene mapped to human chromosome 6p21.2. KIF6 protein belongs to the kinesin superfamily and is characterized by a non-conserved tail domain with a coiled-coil structure, which associates with its cargo and aids protein-protein interactions and transport. The encoded protein is expressed in a variety of tissues and cell types, including vascular cells.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|