Merck Anti-RASAL3 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA043417-100UL | - | Merck HPA043417-100UL Anti-RASAL3 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 895,700원 | - | 985,270원 |
다른 상품 둘러보기
Anti-RASAL3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
LGLVRKPRRPPPPTMDPPSPSRTSQTQPTATSPLTSYRWHTGGGGEKAAGGFRWGRFAGWGRALSHQEPMVSTQPAPRSIFRRVL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... RASAL3(64926)
RASAL3 (RAS protein activator like 3) is a Ras GTPase-activating protein. It is expressed in cells of hematopoietic lineages like NKT (natural killer T), B and T cells. RASAL3 has 18 exons and is located on human chromosome 19p13.12. It is made of 1011 amino acids. It is a member of the RASAL family that has pleckstrin homology (PH), C2, and RasGAP domains. RASAL3 is present in the cytoplasm.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|