Merck Anti-ANXA4 antibody produced in rabbit
Merck의 Anti-ANXA4 rabbit polyclonal antibody로, 인간·마우스·랫트에서 반응합니다. Prestige Antibodies® 라인으로 고품질 검증된 항체이며, immunoblotting, immunofluorescence, immunohistochemistry에 적합합니다. −20°C에서 보관하며 wet ice로 배송됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-ANXA4 antibody produced in rabbit
Anti-ANXA4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human, Mouse, Rat |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Orthogonal RNAseq |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:500–1:1000 |
| 면역원 서열 | KGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQ |
| UniProt 수납 번호 | P09525 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
ANXA4 (annexin A4) gene encodes a protein that is a member of the annexin family of calcium-dependent phospholipid binding proteins.
These proteins contain divergent NH₂-terminal ‘head’ domain that confers specific properties to the individual annexin and a conserved 34 kDa COOH-terminal protein core that binds to calcium and membrane.
Annexin 4 was first identified in homogenates of human placenta. It is expressed in several tissues such as secretory epithelia in the lung, stomach, intestine, and kidney, and is associated with polarized epithelial cells.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.