Merck Anti-DUOX1 antibody produced in rabbit
다른 상품 둘러보기
Anti-DUOX1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:50-1:200
면역원 서열
QHKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQP
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... DUOX1(53905)
The gene DUOX1 (dual oxidase 1) encodes a protein belonging to the family of NADPH oxidase/heme peroxidase proteins, Duox, and shares upto 85% amino acid similarity with another Duox isoform, Duox2. It contains an NAD(P)H oxidase domain and a heme peroxidase domain. The NAD(P)H oxidase domain of this protein is involved in H2O2 production and the heme peroxidase domain is similar to several peroxidases, but its function is yet to be characterized. The expression of Duox1 is stimulated by Th2 (T helper) cytokines, IL-4 (interleukin-4) and IL-13 (interleukin-13). The gene is mapped to human chromosome 15q15.3.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|