
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-GDF3 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-GDF3 항체로 인간 GDF3 단백질에 반응합니다. Prestige Antibodies® 라인 제품이며, affinity isolated 형태입니다. 면역블롯 및 면역조직화학에 적합하며, −20°C에서 보관합니다.
- 카탈로그번호
- HPA018468-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:39
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA018468-100UL Anti-GDF3 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-GDF3 antibody produced in rabbit
Anti-GDF3 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.
생물학적 정보
- 생물학적 소스: Rabbit
- 클론: Polyclonal
- 항체 형태: Affinity isolated antibody
- 결합: Unconjugated
- 제품 라인: Prestige Antibodies® Powered by Atlas Antibodies
- 형태(Form): Buffered aqueous glycerol solution
- Species Reactivity: Human
- Antibody Product Type: Primary antibodies
품질 및 검증
- Quality Level: 100
- 향상된 검증: Recombinant expression
자세한 내용은 Antibody Enhanced Validation 참고
실험 적용
| Technique | Working Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunohistochemistry | 1:20–1:50 |
면역원 서열
HKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVUniProt 정보
- Accession Number: Q9NR23
유전자 정보
- Gene: GDF3 (9573)
- 설명:
The growth differentiation factor-3 (GDF3) gene is mapped to human chromosome 12p13.1. It belongs to the bone morphogenic protein/GDF class of the transforming growth factor-β superfamily. GDF3 is expressed in embryonic stem cells and the early embryo. It is also detected in primary hippocampal neurons and brain tissues. The protein is localized in the cytoplasm.
취급 및 보관
| 항목 | 내용 |
|---|---|
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



