CacheBy
Merck Anti-GDF3 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-GDF3 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-GDF3 항체로 인간 GDF3 단백질에 반응합니다. Prestige Antibodies® 라인 제품이며, affinity isolated 형태입니다. 면역블롯 및 면역조직화학에 적합하며, −20°C에서 보관합니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Merck HPA018468-100UL Anti-GDF3 antibody produced in rabbit, 100uL pk판매 단위 pk
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-GDF3 antibody produced in rabbit

Anti-GDF3 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.

생물학적 정보

  • 생물학적 소스: Rabbit
  • 클론: Polyclonal
  • 항체 형태: Affinity isolated antibody
  • 결합: Unconjugated
  • 제품 라인: Prestige Antibodies® Powered by Atlas Antibodies
  • 형태(Form): Buffered aqueous glycerol solution
  • Species Reactivity: Human
  • Antibody Product Type: Primary antibodies

품질 및 검증

실험 적용

Technique Working Concentration
Immunoblotting 0.04–0.4 μg/mL
Immunohistochemistry 1:20–1:50

면역원 서열

HKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVV

UniProt 정보

유전자 정보

  • Gene: GDF3 (9573)
  • 설명:
    The growth differentiation factor-3 (GDF3) gene is mapped to human chromosome 12p13.1. It belongs to the bone morphogenic protein/GDF class of the transforming growth factor-β superfamily. GDF3 is expressed in embryonic stem cells and the early embryo. It is also detected in primary hippocampal neurons and brain tissues. The protein is localized in the cytoplasm.

취급 및 보관

항목 내용
배송 상태 Wet ice
저장 온도 −20°C

Merck Sigma 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.