Merck Anti-PLGRKT antibody produced in rabbit

Anti-PLGRKT antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

생물학적 소스

rabbit

Quality Level

100

결합

unconjugated

항체 형태

affinity isolated antibody

antibody product type

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human, rat

포장

antibody small pack of 25 μL

향상된 검증

RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

면역원 서열

KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK

배송 상태

wet ice

저장 온도

−20°C

Gene Information

human ... C9orf46(55848)

PLGRKT (plasminogen receptor, C-terminal lysine transmembrane protein) is a transmembrane receptor, which has its C-terminal at the cell surface, containing an exposed lysine residue. It is a plasminogen receptor, and binds to it through its lysine residue. PLGRKT has a molecular weight of 17,261Da, and contains 147 amino acids. It is a highly conserved protein which shows high homology in different species. It has expression levels in catecholaminergic tissues. Its trancript is also expressed in pheochromocytoma tissues, medulla of adrenal gland, hippocampus, cerebral cortex, cerebellum and sympathetic neurons. PLGRKT is also highly expressed in human peripheral blood monocytes and monocytoid cells. This gene is present on the human chromosome 9p24.1.