Merck Anti-TRIO antibody produced in rabbit
Rabbit polyclonal anti-TRIO antibody for human detection, affinity isolated and supplied in buffered aqueous glycerol solution. Suitable for immunohistochemistry (1:20–1:50). Validated by orthogonal RNAseq and stored at −20°C.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-TRIO antibody produced in rabbit
Anti-TRIO antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Orthogonal RNAseq (Enhanced Validation) |
| Technique(s) | Immunohistochemistry: 1:20–1:50 |
| 면역원 서열 | MLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPN |
| UniProt 수납 번호 | O75962 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
Gene Information
TRIO (trio Rho guanine nucleotide exchange factor)
Gene symbol: TRIO (7204)
Located on human chromosome 5p15.2.
The encoded protein contains three functional domains: a serine/threonine kinase domain and two guanine nucleotide exchange factor (GEF) domains specific for Rac1 and RhoA, members of the Rho-like GTPase family.
The GEF domains include a DH-domain (Dbl-homology domain) that may contribute to exchange factor activity and the oncogenic potential of the Dbl oncogene.
제품 이미지
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.