CacheBy
Merck Anti-TRIO antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-TRIO antibody produced in rabbit

상품 한눈에 보기

Rabbit polyclonal anti-TRIO antibody for human detection, affinity isolated and supplied in buffered aqueous glycerol solution. Suitable for immunohistochemistry (1:20–1:50). Validated by orthogonal RNAseq and stored at −20°C.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-TRIO antibody produced in rabbit

Anti-TRIO antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution.


제품 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
Antibody Product Type Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태(Form) Buffered aqueous glycerol solution
Species Reactivity Human
포장 Antibody small pack of 25 μL
향상된 검증 Orthogonal RNAseq (Enhanced Validation)
Technique(s) Immunohistochemistry: 1:20–1:50
면역원 서열 MLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPN
UniProt 수납 번호 O75962
배송 상태 Wet ice
저장 온도 −20 °C

Gene Information

TRIO (trio Rho guanine nucleotide exchange factor)
Gene symbol: TRIO (7204)
Located on human chromosome 5p15.2.
The encoded protein contains three functional domains: a serine/threonine kinase domain and two guanine nucleotide exchange factor (GEF) domains specific for Rac1 and RhoA, members of the Rho-like GTPase family.
The GEF domains include a DH-domain (Dbl-homology domain) that may contribute to exchange factor activity and the oncogenic potential of the Dbl oncogene.


제품 이미지

Merck Sigma 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.