Merck Anti-LXN antibody produced in rabbit
다른 상품 둘러보기
Anti-LXN antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
mouse, rat, human
포장
antibody small pack of 25 μL
향상된 검증
RNAi knockdown
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTF
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... LXN(56925)
The gene LXN (latexin) encodes a 222-residue that contains two topologically equivalent subdomains with an α-helix surrounded by a curved β-sheet. A third α-helix forms a connection linking the subdomains. It is also called as tissue or endogenous carboxypeptidase inhibitor (CPI) and is predominantly expressed in the heart, prostate, ovary, kidney, pancreas, and colon and to some extent in the brain. The encoded protein is larger than plant and parasite CPIs and does not contain the conserved 7-residue C terminus that is present in the shorter CPIs. This indicates that the mechanism of CPA inhibition varies between latexin and plant/parasite CPIs. The gene is mapped to human chromosome 3q25.32.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|