상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA014036-100UL | - | Merck HPA014036-100UL Anti-DPCR1 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 894,810원 | - | 984,291원 |
Anti-DPCR1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
KTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... DPCR1(135656)
The gene DPCR1 (diffuse panbronchiolitis critical region 1), located in the major histocompatibility complex class I, encodes a 235-amino acid protein that shares homology with the mucin-like domain of sperm multiple-domain transmembrane protein called zonadhesin, which has the ability to bind to sperm zona pellucida. The gene spans a length of 2.5kb and is also referred to as C6orf37 (Chromosome 6 open reading frame 37). It is predominantly expressed in lung, kidney, and testis.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|