| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA025224-100UL | - | Merck HPA025224-100UL Anti-SDR16C5 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 948,780원 | - | 1,043,658원 | |
다른 상품 둘러보기
Anti-SDR16C5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFVDQKKKL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SDR16C5(195814)
The gene SDR16C5 (short chain dehydrogenase/reductase family 16C, member 5) is mapped to human chromosome 8q12.1. It belongs to the SDR family of proteins and contain three conserved motifs associated with the family. It localizes in the membrane of endoplasmic reticulum. SDR16C5 is commonly referred to as RDH-E2 (epidermal retinol dehydrogenase 2).
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|