Merck Anti-FXYD5 antibody produced in rabbit
다른 상품 둘러보기
Anti-FXYD5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FXYD5(53827)
FXYD5 (FXYD domain containing ion transport regulator 5) is a cancer-associated glycoprotein localized to the cell surface. It belongs to the family of FXYD proteins, which interacts with and modulate Na,K-ATPase. These proteins span the cell membrane once. The cDNA for this gene codes for a protein of 178 amino acids, containing a single transmembrane domain, a short cytoplasmic tail. It also has a putative O-glycosylated extracellular region as well as a signal peptide. This gene is present with the human chromosome locus 19q13.12. Under normal conditions, it is expressed in only specific tissues. These are generally epithelial tissues such as, lung, kidney and intestine. It is also expressed in normal lymphocytes, as well as in stratified squamous epithelia, in the basal and endothelial cells.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|