AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-QKI antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-QKI 항체로, 인간·쥐·흰쥐 시료에 반응하는 polyclonal 1차 항체입니다. Prestige Antibodies® 라인 제품으로, affinity 정제된 glycerol 용액 형태입니다. 면역형광, Western blot, IHC 등 다양한 실험에 적합합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-QKI antibody produced in rabbit
Anti-QKI antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
이 항체는 토끼에서 생산된 polyclonal 항체로, QKI 단백질을 인식합니다. 인간, 쥐, 흰쥐 시료에서 반응하며, immunoblotting, immunofluorescence, immunohistochemistry 등의 실험에 적합합니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibody |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human, Rat, Mouse |
| Packaging | 25 μL small pack |
| Enhanced validation | Orthogonal RNAseq |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:500–1:1000 |
| Immunogen sequence | RAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVL |
| UniProt accession no. | Q96PU8 |
| Shipping conditions | Wet ice |
| Storage temperature | −20 °C |
| Gene information | Human QKI (9444) |
Gene Information
The gene QKI (quaking) is mapped to human chromosome 6q26. It belongs to the signal transduction and activation of RNA (STAR) protein family. QKI contains an RNA-binding KH domain, and different splicing variants of QKI are present in the frontal cortex of the human brain.
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.