Merck Anti-TOMM70 antibody produced in rabbit
다른 상품 둘러보기
Anti-TOMM70 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, mouse
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TOMM70A(9868)
TOMM70A (translocase of outer mitochondrial membrane 70 homolog A) is a human ortholog of Tom70 protein found in yeast. This gene maps to human chromosome 3q13.1-q13.2, spans ~37kb, and consists of 12 exons. The encoded protein has a ubiquitous expression pattern in humans. It is a component of the mitochondrial TOM (translocase of outer membrane) complex, which also includes import pore complex and Tom20. It contains one TPR (tetratricopeptide repeat) clamp domain in its cytoplasmic region, and belongs to the TPR co-chaperone family.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|