Merck Anti-MVP antibody produced in rabbit
Rabbit polyclonal anti-MVP antibody for detection of major vault protein. Suitable for immunoblotting, immunofluorescence, and immunohistochemistry. Unconjugated, affinity-isolated, and provided in buffered aqueous glycerol solution. Stored at −20°C an...
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-MVP antibody produced in rabbit
Anti-MVP antibody produced in rabbit
제품 개요
- Affinity isolated, buffered aqueous glycerol solution
- Anti-Lung resistance-related protein antibody produced in rabbit
- Anti-Major vault protein antibody produced in rabbit
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
적용 기술
| Technique | Working Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:200–1:500 |
면역원 서열
VFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... MVP(9961)
제품 설명
Major vault protein (MVP) is the major vault protein with a molecular mass of 110 kDa.
It is involved in nucleo-cytoplasmic transport and encodes for multidrug resistance-associated protein and protein kinase C-β.
MVP may influence cellular drug resistance (doxorubicin, vincristine, etoposide, paclitaxel, and gramicidin D) through transport processes.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.