Merck Anti-L1CAM antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA005830-100UL | - | Merck HPA005830-100UL Anti-L1CAM antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 817,800원 | - | 899,580원 |
다른 상품 둘러보기
Anti-L1CAM antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:200- 1:500
면역원 서열
ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... L1CAM(3897)
The gene L1CAM (L1 cell adhesion molecule) encodes a member of the immunoglobulin supergene family. The encoded protein contains a cytoplasmic intracellular domain, one single-pass transmembrane region and an extracellular domain containing six immunoglobulin- (Ig) and five fibronectin (Fn) III-like motifs. The gene is mapped to human chromosome Xq28. It contains 29 exons that encode a protein of 1257 amino acids containing a 19 amino acid signal peptide and a functional L1 protein of 1238 amino acids. It is mainly expressed in the nervous system.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|