AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-AK1 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-AK1 폴리클로날 항체로 Atlas Antibodies의 Prestige Antibodies® 라인 제품입니다. 인간, 생쥐, 랫트 반응성이 있으며 immunoblotting, immunofluorescence, immunohistochemistry에 적합합니다. −20°C에서 보관하며 orthogonal RNAseq으로 향상된 검증을 거쳤습니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-AK1 antibody produced in rabbit
Anti-AK1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
- Biological Source: Rabbit
- Quality Level: 100
- Conjugation: Unconjugated
- Antibody Form: Affinity isolated antibody
- Antibody Type: Primary antibodies
- Clone: Polyclonal
- Product Line: Prestige Antibodies® Powered by Atlas Antibodies
- Form: Buffered aqueous glycerol solution
- Species Reactivity: Rat, Mouse, Human
- Packaging: Antibody small pack of 25 μL
- Enhanced Validation: Orthogonal RNAseq
- Learn more about Antibody Enhanced Validation (Merck Technical Article)
적용 기술 및 사용 농도
| Technique | Recommended Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:500–1:1000 |
Immunogen Sequence
EKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSUniProt Accession Number
배송 및 보관 조건
| Condition | Description |
|---|---|
| Shipping | Wet ice |
| Storage Temperature | −20°C |
Gene Information
Human AK1 (adenylate kinase 1) gene is localized to human chromosome 9q34.1.
The encoded protein consists of 194 amino acids and forms a single polypeptide chain.
Its C-terminal contains lysine and N-terminal contains acetylmethionine.
AK1 is one of three isoforms of the AK enzyme and the most common.
It is a polymorphic gene with five known alleles.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.