
Merck Anti-AK1 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AK1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
rat, mouse, human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
EKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... AK1(203)
AK1 (adenylate kinase 1) gene is localized to human chromosome 9q34.1. The encoded protein is composed of 194 amino acids, and is made of a single polypeptide chain. Its C-terminal contains a lysine and its N-terminal contains an acetylmethionine. It is one of the three and the most common isoforms of AK enzyme. It is a polymorphic gene, and this is attributable to its five alleles.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-FSCN1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-MYL7 antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-AK1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-VASP antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-LMNA antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|