AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-SLCO1B3 antibody produced in rabbit
상품 한눈에 보기
SLCO1B3 단백질을 인식하는 토끼 유래 폴리클로날 항체로, 인간 시료에 반응. 면역형광 및 면역조직화학에 적합하며, 친화 분리된 항체 형태로 제공. −20°C에서 보관하며, 항체 향상 검증을 거침.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-SLCO1B3 antibody produced in rabbit
Anti-SLCO1B3 antibody produced in rabbit
제품 개요
- Affinity isolated antibody
- Buffered aqueous glycerol solution
- Primary antibody (polyclonal)
- Unconjugated
생물학적 소스
rabbit
스펙 정보
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 클론 | Polyclonal |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Small pack of 25 μL |
| 향상된 검증 | Recombinant expression, Orthogonal RNAseq |
| Technique(s) | Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:500–1:1000 |
| 면역원 서열 | QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA |
| UniProt 수납 번호 | Q9NPD5 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human SLCO1B3(28234) |
제품 설명
The organic anion transporting polypeptides (OATPs) are membrane-bound transporters belonging to the SLC (solute carrier) superfamily.
SLCO1B3 (solute carrier organic anion transporter family, member 1B3) or OATP1B3 is a drug transporter, which belongs to the OATP1B subfamily.
It is expressed in hepatocytes at the basolateral membrane. SLCO1B3 gene has two major single nucleotide polymorphisms (SNPs) at exon 3 and 6, and these polymorphic variations determine the characteristics of the transportations of various substrates.
The gene is located in the chromosomal region 12p12.
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.