
Merck Anti-SLCO1B3 antibody produced in rabbit
SLCO1B3 단백질을 인식하는 토끼 유래 폴리클로날 항체로, 인간 시료에 반응. 면역형광 및 면역조직화학에 적합하며, 친화 분리된 항체 형태로 제공. −20°C에서 보관하며, 항체 향상 검증을 거침.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLCO1B3 antibody produced in rabbit
제품 개요
- Affinity isolated antibody
- Buffered aqueous glycerol solution
- Primary antibody (polyclonal)
- Unconjugated
생물학적 소스
rabbit
스펙 정보
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 클론 | Polyclonal |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Small pack of 25 μL |
| 향상된 검증 | Recombinant expression, Orthogonal RNAseq |
| Technique(s) | Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:500–1:1000 |
| 면역원 서열 | QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA |
| UniProt 수납 번호 | Q9NPD5 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human SLCO1B3(28234) |
제품 설명
The organic anion transporting polypeptides (OATPs) are membrane-bound transporters belonging to the SLC (solute carrier) superfamily.
SLCO1B3 (solute carrier organic anion transporter family, member 1B3) or OATP1B3 is a drug transporter, which belongs to the OATP1B subfamily.
It is expressed in hepatocytes at the basolateral membrane. SLCO1B3 gene has two major single nucleotide polymorphisms (SNPs) at exon 3 and 6, and these polymorphic variations determine the characteristics of the transportations of various substrates.
The gene is located in the chromosomal region 12p12.
제품 이미지
(이미지 없음)
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-EMD antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-SIRT3 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-SLCO1B3 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-PRRT2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-DCAF11 antibody produced in rabbit
817,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|