AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-TAGLN antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-TAGLN 항체로, human TAGLN 단백질을 인식하는 polyclonal primary antibody입니다. Affinity isolated 형태로 immunoblotting, immunofluorescence, immunohistochemistry 등 다양한 분석에 적합합니다. −20°C에서 보관하며 wet ice 상태로 배송됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-TAGLN antibody produced in rabbit
Anti-TAGLN antibody produced in rabbit
제품 개요
Affinity isolated rabbit polyclonal antibody로, human TAGLN (transgelin) 단백질을 인식합니다. Buffered aqueous glycerol solution 형태로 제공되며, 다양한 면역 분석 기술에 사용 가능합니다.
스펙 정보
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Product Type | Primary antibodies |
| Clone | Polyclonal |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Enhanced Validation | Orthogonal RNAseq |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:200–1:500 |
| Immunogen Sequence | EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV |
| UniProt Accession | Q01995 |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
| Gene Information | Human TAGLN (6876) |
Gene Information 상세
The gene TAGLN (transgelin) is mapped to human chromosome 11q23.2. It belongs to the calponin family, and the protein is strongly expressed in smooth muscle tissues.
제품 이미지
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.