
Merck Anti-TAGLN antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-TAGLN 항체로, human TAGLN 단백질을 인식하는 polyclonal primary antibody입니다. Affinity isolated 형태로 immunoblotting, immunofluorescence, immunohistochemistry 등 다양한 분석에 적합합니다. −20°C에서 보관하며 wet ice 상태로 배송됩니다.
브랜드: Merck Sigma
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TAGLN antibody produced in rabbit
제품 개요
Affinity isolated rabbit polyclonal antibody로, human TAGLN (transgelin) 단백질을 인식합니다. Buffered aqueous glycerol solution 형태로 제공되며, 다양한 면역 분석 기술에 사용 가능합니다.
스펙 정보
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Product Type | Primary antibodies |
| Clone | Polyclonal |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Enhanced Validation | Orthogonal RNAseq |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:200–1:500 |
| Immunogen Sequence | EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV |
| UniProt Accession | Q01995 |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
| Gene Information | Human TAGLN (6876) |
Gene Information 상세
The gene TAGLN (transgelin) is mapped to human chromosome 11q23.2. It belongs to the calponin family, and the protein is strongly expressed in smooth muscle tissues.
제품 이미지
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-CAMK2B antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-ACTN2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-TAGLN antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-PSPC1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-XRCC4 antibody produced in rabbit
817,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.