Merck Anti-GAS8 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-GAS8 항체로, 인간 GAS8 단백질을 인식하는 polyclonal 1차 항체입니다. 면역블롯 및 면역형광에 적합하며, 정제된 glycerol 완충 용액 형태로 제공됩니다. −20°C에서 보관하며 orthogonal RNAseq로 향상된 검증을 거쳤습니다.

브랜드: Merck Sigma
카테고리: Polyclonal Antibodies

#Merck #Sigma #Merck Sigma

Merck Sigma · Merck Anti-GAS8 antibody produced in rabbit

Anti-GAS8 antibody produced in rabbit

제품 개요

유형: affinity isolated antibody
형태: buffered aqueous glycerol solution
결합: unconjugated
항체 종류: primary antibody
클론: polyclonal
생물학적 소스: rabbit

스펙 정보

항목	내용
Species reactivity	Human
Packaging	Small pack of 25 μL
Quality Level	100
Form	Buffered aqueous glycerol solution
Conjugation	Unconjugated
Validation	Orthogonal RNAseq (Enhanced Validation)
Techniques	Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL
Immunogen sequence	VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG
UniProt accession	O95995
Shipping conditions	Wet ice
Storage temperature	−20 °C

유전자 정보

Gene: GAS8 (2622)
Growth-arrest specific 8 (GAS8), also known as GAS11, spans approximately 25 kb and contains 11 exons. It is expressed in various mammalian cells lacking motile cilia. The gene is located on human chromosome 16q24.3. In vertebrate cells, GAS8 localizes to the axoneme of motile cilia and to the base of primary cilia.