
Merck Anti-GAS8 antibody produced in rabbit
토끼에서 생산된 Anti-GAS8 항체로, 인간 GAS8 단백질을 인식하는 polyclonal 1차 항체입니다. 면역블롯 및 면역형광에 적합하며, 정제된 glycerol 완충 용액 형태로 제공됩니다. −20°C에서 보관하며 orthogonal RNAseq로 향상된 검증을 거쳤습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GAS8 antibody produced in rabbit
제품 개요
- 유형: affinity isolated antibody
- 형태: buffered aqueous glycerol solution
- 결합: unconjugated
- 항체 종류: primary antibody
- 클론: polyclonal
- 생물학적 소스: rabbit
스펙 정보
| 항목 | 내용 |
|---|---|
| Species reactivity | Human |
| Packaging | Small pack of 25 μL |
| Quality Level | 100 |
| Form | Buffered aqueous glycerol solution |
| Conjugation | Unconjugated |
| Validation | Orthogonal RNAseq (Enhanced Validation) |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL |
| Immunogen sequence | VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG |
| UniProt accession | O95995 |
| Shipping conditions | Wet ice |
| Storage temperature | −20 °C |
유전자 정보
Gene: GAS8 (2622)
Growth-arrest specific 8 (GAS8), also known as GAS11, spans approximately 25 kb and contains 11 exons. It is expressed in various mammalian cells lacking motile cilia. The gene is located on human chromosome 16q24.3. In vertebrate cells, GAS8 localizes to the axoneme of motile cilia and to the base of primary cilia.
향상된 검증
본 항체는 orthogonal RNAseq 기반의 Antibody Enhanced Validation 절차를 통해 검증되었습니다.
자세한 내용은 Antibody Enhanced Validation 페이지를 참고하십시오.
제품 이미지
(이미지 없음)
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-GLUL antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-ROCK2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-GAS8 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-PLN antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-OXCT1 antibody produced in rabbit
817,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|