Merck Anti-LCP1 antibody produced in rabbit
다른 상품 둘러보기
Anti-LCP1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
rat, human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... LCP1(3936)
LCP1 (Lymphocyte cytosolic protein 1) is an actin-binding protein belonging to a large family of actin filament cross-linking proteins. It was firstly identified as an isoform of intestinal brush-border fimbrin. It consists of a calmodulin-like headpiece domain at the N-terminal end, which is equipped with two helix-loop-helix EF-hand Ca2+ binding motifs, followed by two independent actin-binding domains (ABDs) within the same region. It is localized to actin-rich membrane structures.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|