
Merck Anti-LCP1 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LCP1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
rat, human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
FAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKI
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... LCP1(3936)
LCP1 (Lymphocyte cytosolic protein 1) is an actin-binding protein belonging to a large family of actin filament cross-linking proteins. It was firstly identified as an isoform of intestinal brush-border fimbrin. It consists of a calmodulin-like headpiece domain at the N-terminal end, which is equipped with two helix-loop-helix EF-hand Ca2+ binding motifs, followed by two independent actin-binding domains (ABDs) within the same region. It is localized to actin-rich membrane structures.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-SFPQ antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-ZNF217 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-LCP1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-PBRM1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-FMR1 (C-terminal) antibody produced in rabbit
843,600원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|