다른 상품 둘러보기
Anti-LAIR1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... LAIR1(3903)
Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) is a transmembrane glycoprotein which is a part of the leukocyte receptor complex (LRC)-encoded family. In its cytoplasmic domain, it contains two immunoreceptor tyrosine-based inhibition motifs (ITIMs). It is widely expressed on immune cells such as B cells, T cells, natural killer (NK) cells, monocytes, dendritic cells and CD34+ hematopoietic progenitor cells. LAIR-1 gene maps to human chromosome 19q13.4, and codes for a type I transmembrane protein, consisting of 287 amino acids. It has one C2-type Ig-like domain in its exoplasmic region. This gene contains 10 exons, and alternative splicing gives rise to many isosforms such as, LAIR-1a, LAIR-1b, LAIR-1c and LAIR-1d.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|