상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA009300-100UL | - | Merck HPA009300-100UL Anti-CD93 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 868,530원 | - | 955,383원 |
Anti-CD93 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
independent
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
FNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSSGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CD93(22918)
CD93 (cluster of differentiation 93) is a cell surface receptor for heat-sensitive complement factor C1q, and hence, is also called C1qR. This protein shows major expression on endothelial cells. In neonatal umbilical cord blood cells (UCBCs) this protein is co-expressed on naive T-lymphocytes (CD4+ CD45RA+ cells). However, this protein is absent in adult peripheral blood cells (PBCs). It is a heavily O-glycosylated type I transmembrane protein. Its predominant expression is on endothelial cells, monocytes, granulocytes, and immature hematopoietic progenitor cells (CD34+ hematopoietic stem cells). It has a molecular weight of 90-100kDa. In soluble form it is found in human plasma.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|