Merck Anti-CKAP4 antibody produced in rabbit
Rabbit에서 생산된 Anti-CKAP4 폴리클로날 항체로, 인간 CKAP4 단백질 검출에 적합. IHC 및 Western blot에 사용 가능. Prestige Antibodies® 라인 제품으로 −20°C 보관. Affinity purified, buffered glycerol 용액 형태.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-CKAP4 antibody produced in rabbit
Anti-CKAP4 antibody produced in rabbit
제품 개요
Ab1, Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 정보
- Biological source: Rabbit
- Clonality: Polyclonal
- Product type: Primary antibody
- Species reactivity: Human
- Gene: CKAP4 (10970)
- UniProt accession: Q07065
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태 및 포장
- Form: Buffered aqueous glycerol solution
- Packaging: Small pack of 25 μL
결합 및 형태
- Conjugation: Unconjugated
- Antibody form: Affinity isolated antibody
품질 등급
Quality Level: 100 (M-Clarity Program)
향상된 검증 (Enhanced Validation)
- Independent
- Orthogonal RNAseq
자세한 내용은 Antibody Enhanced Validation 참조
적용 기술
| Technique | Dilution / Concentration |
|---|---|
| Immunohistochemistry (IHC) | 1:50–1:200 |
| Western blot | 0.04–0.4 μg/mL |
면역원 서열
SRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQ
배송 및 보관
| 항목 | 조건 |
|---|---|
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
단백질 정보
Cytoskeleton-associated protein 4 (CKAP4), also known as p63, is a 63 kDa type II transmembrane receptor protein. It includes a 106-amino acid cytosolic tail at the NH2 terminus, a transmembrane domain, and a 474-amino acid extracytoplasmic domain at the COOH terminus.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.