Merck Anti-CACFD1 antibody produced in rabbit
다른 상품 둘러보기
Anti-CACFD1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 0.04-0.4 μg/mL
면역원 서열
NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... C9orf7(11094)
CACFD1 (calcium channel flower domain containing 1) is a synaptic vesicle-associated Ca2+ channel. It is also called Flower protein, and has three or four transmembrane segments. Its second transmembrane domain contains a 9 residue motif, which shares homology to selectivity filters found in VGCCs and transient receptor potential channels (TRPV5 and 6).
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|