Merck Anti-ROCK1 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA007567-100UL | - | Merck HPA007567-100UL Anti-ROCK1 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 817,800원 | - | 899,580원 |
다른 상품 둘러보기
Anti-ROCK1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, rat, mouse
포장
antibody small pack of 25 μL
향상된 검증
RNAi knockdown
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
TQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERT
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ROCK1P1(727758)
ROCK (Rho-associated, coiled-coil containing protein kinase) has two isoforms, ROCK1 and ROCK2 that share 65% sequence similarity. ROCK has three domains that include the N-terminal catalytic domain (CAT), a middle coiled-coil domain that mediates homodimerization, and Rho-binding (RB) and pleckstrin homology (PH) domains (RB/PH domain) at the C-terminus. The RB/PH domain acts as an autoinhibitory domain and suppresses the kinase activity of CAT. ROCK1 (Rho-associated, coiled-coil containing protein kinase 1) gene encodes a 160kDa serine/threonine kinase that specifically binds to GTP-bound Rho. It is a platelet protein with 1354 amino acids. It has a Ser/Thr kinase domain in its N-terminus, followed by a 600 amino acid long coiled-coil structure. The C-terminal region contains a cysteine-rich zinc finger-like motif and a pleckstrin homology region.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|