Merck Anti-ROCK1 antibody produced in rabbit

Anti-ROCK1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

생물학적 소스

rabbit

Quality Level

100

결합

unconjugated

항체 형태

affinity isolated antibody

antibody product type

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, rat, mouse

포장

antibody small pack of 25 μL

향상된 검증

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

면역원 서열

TQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERT

배송 상태

wet ice

저장 온도

−20°C

Gene Information

human ... ROCK1P1(727758)

ROCK (Rho-associated, coiled-coil containing protein kinase) has two isoforms, ROCK1 and ROCK2 that share 65% sequence similarity. ROCK has three domains that include the N-terminal catalytic domain (CAT), a middle coiled-coil domain that mediates homodimerization, and Rho-binding (RB) and pleckstrin homology (PH) domains (RB/PH domain) at the C-terminus. The RB/PH domain acts as an autoinhibitory domain and suppresses the kinase activity of CAT. ROCK1 (Rho-associated, coiled-coil containing protein kinase 1) gene encodes a 160kDa serine/threonine kinase that specifically binds to GTP-bound Rho. It is a platelet protein with 1354 amino acids. It has a Ser/Thr kinase domain in its N-terminus, followed by a 600 amino acid long coiled-coil structure. The C-terminal region contains a cysteine-rich zinc finger-like motif and a pleckstrin homology region.