AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-FH antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-FH 항체로, human, mouse, rat에 반응합니다. Prestige Antibodies® 제품으로, affinity isolated 형태이며 immunoblotting 및 immunohistochemistry에 적합합니다. FH 유전자 관련 연구에 활용됩니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:39
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA027341-100UL Anti-FH antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
840,700원VAT 포함 924,770원
Merck Sigma · Merck Anti-FH antibody produced in rabbit
Anti-FH antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, ab3
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human, Mouse, Rat |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Independent (Antibody Enhanced Validation) |
| 적용 기술 | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:1000–1:2500 |
| 면역원 서열 | HFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIK |
| UniProt 번호 | P07954 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| 유전자 정보 | FH (2271) |
Gene Information
The gene FH (fumarate hydratase) is mapped to human chromosome 1q42.3–q43.
The encoded protein catalyzes the conversion of fumarate to malate in the tricarboxylic acid (TCA) cycle.
Fumarate acts as an oncometabolite, and mutations in the FH gene lead to fumarate accumulation.
These mutations are associated with HLRCC (hereditary leiomyomatosis and renal cell cancer) syndrome and can also cause fumarase deficiency, resulting in neurological impairment.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.