
Merck Anti-FH antibody produced in rabbit
토끼에서 생산된 Anti-FH 항체로, human, mouse, rat에 반응합니다. Prestige Antibodies® 제품으로, affinity isolated 형태이며 immunoblotting 및 immunohistochemistry에 적합합니다. FH 유전자 관련 연구에 활용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-FH antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, ab3
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human, Mouse, Rat |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Independent (Antibody Enhanced Validation) |
| 적용 기술 | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:1000–1:2500 |
| 면역원 서열 | HFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIK |
| UniProt 번호 | P07954 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| 유전자 정보 | FH (2271) |
Gene Information
The gene FH (fumarate hydratase) is mapped to human chromosome 1q42.3–q43.
The encoded protein catalyzes the conversion of fumarate to malate in the tricarboxylic acid (TCA) cycle.
Fumarate acts as an oncometabolite, and mutations in the FH gene lead to fumarate accumulation.
These mutations are associated with HLRCC (hereditary leiomyomatosis and renal cell cancer) syndrome and can also cause fumarase deficiency, resulting in neurological impairment.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-ERLIN2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-ATN1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-FH antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-DNMT3A antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-WDHD1 antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|