상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA036723-100UL | Merck HPA036723-100UL Anti-CD34 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 840,840원 | - | 924,924원 |
다른 상품 둘러보기
Anti-CD34 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
UniProt 수납 번호
application(s)
research pathology
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CD34(947)
CD34 (cluster of differentiation 34) molecule, a cell surface antigen, is expressed in hematopoietic stem cells and vascular endothelium. This gene is 26 kb in length and contain 8 exons. CD34 is a 115 kDa type I transmembrane glycoprotein with a protein backbone of approximately 40 kDa. It is also expressed on all vascular endothelial cells of adults and embryos. CD34 is located on human chromosome 1q32.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|