| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA010553-100UL | Merck HPA010553-100UL Anti-MFAP5 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 894,810원 | - | 984,291원 | |
Anti-MFAP5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL
면역원 서열
GVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MFAP5(8076)
MFAP5 (microfibrillar associated protein 5), also known as MAGP-2 (microfibril-associated glycoprotein 2) is a firbillin-interacting component of the ECM (extracellular matrix). It is found in elastin-associated or isolated microfibrills. MAGP1 and MAG2 form a family of small extracellular matrix microfibril-associated proteins.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|