상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA015247-100UL | Merck HPA015247-100UL Anti-GPRC5B antibody produced in rabbit, 100uL pk | 재고문의 | pk | 894,810원 | - | 984,291원 |
Anti-GPRC5B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500
면역원 서열
IHCTLLPALQENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAP
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... GPRC5B(51704)
GPRC5B (G protein-coupled receptor, class C, group 5, member B) is a type 3 G-protein coupled receptor (GPCR), belonging to the Raig subfamily. It contains the seven transmembrane domains characteristic of the GPCR family. Raig subfamily members have a small N-terminal, and apart from GPRC5B, this subfamily contains three other members. This protein is highly expressed in the spinal cord and brain, and has a molecular weight of 68kDa. It is also called retinoic acid- induced gene 2 (RAIG-2). This gene is localized to human chromosome 16p12, and codes for a protein composed of 403 amino acids.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|