
Merck Monoclonal Anti-VGLUT1 antibody produced in mouse
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Monoclonal Anti-VGLUT1 antibody produced in mouse
Prestige Antibodies® Powered by Atlas Antibodies, clone CL2754, purified immunoglobulin, buffered aqueous glycerol solution
Quality Level
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
antibody product type
primary antibodies
클론
CL2754, monoclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, rat, mouse
포장
antibody small pack of 25 μL
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 1 μg/mL
immunohistochemistry: 1:5000- 1:10000
동형
IgG2b
면역원 서열
PSISEEERKYIEDAIGESAKLMNPLTKFSTP
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... VGLUT1(57030)
Vesicular glutamate transporter 1 (VGLUT1), also called as solute carrier family 17 member 7
(SLC17A7), is encoded by the gene mapped to human chromosome 19q13, a region associated with schizophrenia. VGLUT1 is specifically expressed in neuronal cells in the brain and at higher level in neuron-enriched regions such as the amygdala and hippocampus. Glia-enriched areas such as the corpus callosum also show moderate level of expression and substantia nigra, subthalamic nuclei and thalamus show low level expression. VGLUT1 is characterized with a conserved C-terminal dileucine-like motif and two polyproline domains distal to C- terminal end, including one that binds to endocytic BAR (Bin/Amphiphysin/Rvs) domain protein, endophilin.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-TOP2B antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-MYO5B antibody produced in rabbit
370,530원

Merck Sigma
Merck Monoclonal Anti-VGLUT1 antibody produced in mouse
817,800원

Merck Sigma
Merck Anti-PODXL antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-PIP5K3 (N-terminal) antibody produced in rabbit
822,400원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|