Merck Monoclonal Anti-VGLUT1 antibody produced in mouse
Prestige Antibodies® 시리즈의 CL2754 클론 단일클론 항체로, VGLUT1 단백질 검출용. 인간, 생쥐, 랫트 시료에 반응하며 정제된 IgG2b 형태. 면역블롯 및 면역조직화학에 적합하며 −20°C에서 보관.
- 카탈로그번호
- AMAB91041-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Monoclonal Anti-VGLUT1 antibody produced in mouse
Monoclonal Anti-VGLUT1 antibody produced in mouse
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈의 CL2754 클론 단일클론 항체로, 정제된 면역글로불린 형태의 buffered aqueous glycerol 용액입니다. 인간, 생쥐, 랫트 시료에서 VGLUT1 단백질 검출에 사용됩니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| Biological Source | Mouse |
| Conjugate | Unconjugated |
| Antibody Type | Primary antibody |
| Clone | CL2754, monoclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human, Rat, Mouse |
| Packaging | 25 μL (small pack) |
| Enhanced Validation | Orthogonal RNAseq |
| Applications (technique) | Immunoblotting: 1 μg/mL Immunohistochemistry: 1:5000–1:10000 |
| Isotype | IgG2b |
| Immunogen Sequence | PSISEEERKYIEDAIGESAKLMNPLTKFSTP |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20°C |
Gene Information
Human gene: VGLUT1 (57030)
Vesicular glutamate transporter 1 (VGLUT1), also known as solute carrier family 17 member 7 (SLC17A7), is encoded by a gene located on human chromosome 19q13, a region associated with schizophrenia.
VGLUT1 is specifically expressed in neuronal cells, with high expression in neuron-enriched regions such as the amygdala and hippocampus. Moderate expression is found in glia-enriched areas like the corpus callosum, while low expression occurs in the substantia nigra, subthalamic nuclei, and thalamus.
The protein features a conserved C-terminal dileucine-like motif and two polyproline domains near the C-terminal end, including one that binds to the endocytic BAR domain protein, endophilin.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.