
Merck Monoclonal Anti-VGLUT1 antibody produced in mouse
Prestige Antibodies® 시리즈의 CL2754 클론 단일클론 항체로, VGLUT1 단백질 검출용. 인간, 생쥐, 랫트 시료에 반응하며 정제된 IgG2b 형태. 면역블롯 및 면역조직화학에 적합하며 −20°C에서 보관.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Monoclonal Anti-VGLUT1 antibody produced in mouse
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈의 CL2754 클론 단일클론 항체로, 정제된 면역글로불린 형태의 buffered aqueous glycerol 용액입니다. 인간, 생쥐, 랫트 시료에서 VGLUT1 단백질 검출에 사용됩니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| Biological Source | Mouse |
| Conjugate | Unconjugated |
| Antibody Type | Primary antibody |
| Clone | CL2754, monoclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human, Rat, Mouse |
| Packaging | 25 μL (small pack) |
| Enhanced Validation | Orthogonal RNAseq |
| Applications (technique) | Immunoblotting: 1 μg/mL Immunohistochemistry: 1:5000–1:10000 |
| Isotype | IgG2b |
| Immunogen Sequence | PSISEEERKYIEDAIGESAKLMNPLTKFSTP |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20°C |
Gene Information
Human gene: VGLUT1 (57030)
Vesicular glutamate transporter 1 (VGLUT1), also known as solute carrier family 17 member 7 (SLC17A7), is encoded by a gene located on human chromosome 19q13, a region associated with schizophrenia.
VGLUT1 is specifically expressed in neuronal cells, with high expression in neuron-enriched regions such as the amygdala and hippocampus. Moderate expression is found in glia-enriched areas like the corpus callosum, while low expression occurs in the substantia nigra, subthalamic nuclei, and thalamus.
The protein features a conserved C-terminal dileucine-like motif and two polyproline domains near the C-terminal end, including one that binds to the endocytic BAR domain protein, endophilin.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-TOP2B antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-MYO5B antibody produced in rabbit
370,530원

Merck Sigma
Merck Monoclonal Anti-VGLUT1 antibody produced in mouse
817,800원

Merck Sigma
Merck Anti-PODXL antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-PIP5K3 (N-terminal) antibody produced in rabbit
822,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|