
Merck PSF-TEF1-COOH-GST - C-TERMINAL GST TAG YEAST PLASMID
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
PSF-TEF1-COOH-GST - C-TERMINAL GST TAG YEAST PLASMID
plasmid vector for molecular cloning
expression vector, molecular cloning vector, vector, snapfast vector, plasmid vector, cloning vector, plasmid
태그
GST tagged
form
buffered aqueous solution
분자량
size 7371 bp
박테리아 선정
kanamycin
복제개시점
2Micron
pUC (500 copies)
펩타이드 절단
no cleavage
펩타이드 태그 위치
C-terminal
프로모터
Promoter name: TEF1
Promoter activity: constitutive
Promoter type: yeast
리포터 유전자
none
배송 상태
ambient
저장 온도
−20°C
효모 선정
uracil
This plasmid is designed to express tagged proteins in yeast cells (Saccharomyces cerevisiae). The plasmid contains an auxotrophic Uracil selection expression cassette (URA3) that allows for the positive selection of yeast that are deficient in the URA3 gene (YEL021W). This is typically achieved by growing the yeast in minimal media that is reconstituted with the essential amino acids and nucleotides but excluding Uracil.
About the Peptide Tag:This plasmid contains a c-terminal Glutathione-S-Transferase (GST) affinity tag that can be fused to a gene of interest to allow protein detection and/or purification. The sequence of the tag is: SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKS.
About the Cleavage Tag:This plasmid does not contain a protease cleavage site.
Promoter Expression Level: This plasmid contains the Yeast Elongation Factor Alpha promoter (TEF1). This is the strongest of the yeast promoters that we sell. It is a constitutive promoter and requires no induction. If you are interested in weaker promoters levels than we also stock plasmids that contain the following promoters in order of decreasing strength TPI (strong), ADHI (medium), STE5 (weak). We also stock Galactose inducible promoter plasmids if inducible expression is required. Please contact us for further information.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck PSF-MINPROM-SEAP - MINIMAL PROMOTER SEAP PLASMID
761,060원

Merck Sigma
Merck PSF-MINPROM-FLUC - MINIMAL PROMOTER LUCIFERASE PLASMID
761,060원

Merck Sigma
Merck PSF-TEF1-COOH-GST - C-TERMINAL GST TAG YEAST PLASMID
856,850원

Merck Sigma
Merck PSF-MINPROM-RLUC - MINIMAL PROMOTER LUCIFERASE PLASMID
761,060원

Merck Sigma
Merck PSF-OXB20-COOH-TRX - C-TERMINAL TRX SOLUBILITY TAG BACTERIAL PLASMID
881,060원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
