
Atlas Antibodies Anti-THAP11 Antibody
상품 한눈에 보기
인간 THAP11 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 형식으로, 인간에 대해 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-THAP11 Antibody
Target Information
- Target Protein: THAP domain containing 11
- Target Gene: THAP11
- Alternative Gene Names: CTG-B43a, CTG-B45d, HRIHFB2206
Product Description
Polyclonal antibody against human THAP11.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence was used for immunization.
Antigen Sequence:
QLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000036442): 100%
- Rat (ENSRNOG00000019109): 100%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Recommended Applications | Immunohistochemistry (IHC) |
| Verified Species Reactivity | Human |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-THAP12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-THAP11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-THAP11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-THAP10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-THAP11 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.