CacheBy
Atlas Antibodies Anti-TGM4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TGM4 Antibody

상품 한눈에 보기

Human TGM4 단백질에 대한 고특이성 폴리클로날 항체. IHC를 통한 Orthogonal 검증으로 신뢰성 확보. Rabbit 유래 IgG 항체로 다양한 조직에서 적용 가능. PrEST 항원 기반 친화 정제 방식으로 높은 순도 제공.

카탈로그번호
HPA032072-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA032072-100 Anti-TGM4 Antibody, transglutaminase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA032072-25 Anti-TGM4 Antibody, transglutaminase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TGM4 Antibody

Anti-TGM4 Antibody

Target: transglutaminase 4 (TGM4)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human TGM4.


Alternative Gene Names

TGP


Target Information

항목 내용
Target Protein transglutaminase 4
Target Gene TGM4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004320 (58%), Mouse ENSMUSG00000025787 (55%)

Antigen Sequence:
SVNFTVILKRKTAALQNVNILGSFELQLYTGKKMAKLCDLNKTSQIQGQVSEVTLTLDSKTYINSLAILDDEPVIRGFIIAEIVESKEIMA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.