
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TEX33 Antibody
상품 한눈에 보기
Human TEX33 단백질을 인식하는 토끼 폴리클로날 항체로, 정소 특이적 발현 단백질 분석에 적합. IHC 및 WB 검증 완료. 고순도 Affinity 정제 및 안정한 PBS/glycerol buffer 구성. 다양한 생물학 연구용으로 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA005998-100 Anti-TEX33 Antibody, testis expressed 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA005998-25 Anti-TEX33 Antibody, testis expressed 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TEX33 Antibody
Anti-TEX33 Antibody
Target Protein: testis expressed 33 (TEX33)
Product Type: Polyclonal Antibody against Human TEX33
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
- WB (Recombinant expression validation): Verified using target protein overexpression in Western blot.
Product Description
Polyclonal antibody raised in rabbit against human TEX33.
Validated for immunohistochemistry (IHC) and western blot (WB) applications.
Alternative Gene Names
C22orf33, EAN57, MGC35206
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
SSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPTNQKGSIIPNNIRHKFGSNVVDQLVSEEQAQKAIDEVFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNMRSNLFRGAAEETKSLMKASYTPEVIEKS
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000062154 | 65% |
| Rat | ENSRNOG00000056854 | 34% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Isotype | IgG |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Purification | Affinity purified using PrEST antigen |
| Storage | Store at -20°C or below |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



