
Atlas Antibodies Anti-TEX33 Antibody
상품 한눈에 보기
Human TEX33 단백질을 인식하는 토끼 폴리클로날 항체로, 정소 특이적 발현 단백질 분석에 적합. IHC 및 WB 검증 완료. 고순도 Affinity 정제 및 안정한 PBS/glycerol buffer 구성. 다양한 생물학 연구용으로 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TEX33 Antibody
Target Protein: testis expressed 33 (TEX33)
Product Type: Polyclonal Antibody against Human TEX33
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low expression.
- WB (Recombinant expression validation): Verified using target protein overexpression in Western blot.
Product Description
Polyclonal antibody raised in rabbit against human TEX33.
Validated for immunohistochemistry (IHC) and western blot (WB) applications.
Alternative Gene Names
C22orf33, EAN57, MGC35206
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
SSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPTNQKGSIIPNNIRHKFGSNVVDQLVSEEQAQKAIDEVFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNMRSNLFRGAAEETKSLMKASYTPEVIEKS
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000062154 | 65% |
| Rat | ENSRNOG00000056854 | 34% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Isotype | IgG |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Purification | Affinity purified using PrEST antigen |
| Storage | Store at -20°C or below |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TEX37 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TEX37 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TEX33 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TEX26 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TEX30 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.