
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TERT Antibody
상품 한눈에 보기
Human TERT 단백질을 인식하는 폴리클로날 항체로, 텔로머라제 역전사효소 연구에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 ICC 등 다양한 응용에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA054641-100 Anti-TERT Antibody, telomerase reverse transcriptase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054641-25 Anti-TERT Antibody, telomerase reverse transcriptase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TERT Antibody
Anti-TERT Antibody
Target: Telomerase Reverse Transcriptase (TERT)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human TERT. Suitable for research applications involving telomerase reverse transcriptase detection and analysis.
Alternative Gene Names
EST2, hEST2, TCS1, TP2, TRT
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Telomerase Reverse Transcriptase |
| Target Gene | TERT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000025327 | 57% |
| Mouse | ENSMUSG00000021611 | 49% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
Immunocytochemistry (ICC)
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



