CacheBy
Atlas Antibodies Anti-TENM3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TENM3 Antibody

상품 한눈에 보기

Human TENM3 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol과 PBS buffer로 안정화되어 있습니다.

카탈로그번호
HPA047043-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047043-100 Anti-TENM3 Antibody, teneurin transmembrane protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047043-25 Anti-TENM3 Antibody, teneurin transmembrane protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TENM3 Antibody

Anti-TENM3 Antibody

Target: teneurin transmembrane protein 3 (TENM3)
Type: Polyclonal Antibody against Human TENM3


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against human TENM3 protein. It is affinity purified using the PrEST antigen as the affinity ligand.


Alternative Gene Names

KIAA1455, ODZ3, Ten-M3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein teneurin transmembrane protein 3
Target Gene TENM3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000012802 (95%), Mouse ENSMUSG00000031561 (94%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

EPSYELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLN

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.