
Atlas Antibodies Anti-TCAF2 Antibody
상품 한눈에 보기
Human TCAF2 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 실험에 적합합니다. TRPM8 channel associated factor 2를 표적하며, 높은 특이성과 재현성을 제공합니다. Affinity purification 방식으로 정제되어 안정적인 결과를 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TCAF2 Antibody
제품 개요
- Target Protein: TRPM8 channel associated factor 2
- Target Gene: TCAF2
- Type: Polyclonal Antibody
- Host: Rabbit
- Recommended Applications: IHC, ICC
- Verified Species Reactivity: Human
Alternative Gene Names
FAM115C, FAM139A, FLJ40722
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
WLARGQTGKVGVNTNLKDLCPLLSEHGLQCSLEPHLNSDLCVYCCKAYSDKEAKQLQEFVAE - Interspecies Information:
- Mouse ENSMUSG00000029851 (68%)
- Rat ENSRNOG00000030222 (61%)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet
Usage Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Information
제품 스펙
| 항목 | 내용 |
|---|---|
| 공급업체 | Atlas Antibodies |
| 제품명 | Anti-TCAF2 Antibody |
| 형식 | Polyclonal |
| 숙주 | Rabbit |
| 동정 단백질 | TRPM8 channel associated factor 2 |
| 유전자명 | TCAF2 |
| 반응 종 | Human |
| 정제 방법 | Affinity purified |
| 완충액 구성 | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TCEAL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCAP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCAF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCEA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TCAF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.