Atlas Antibodies Anti-TBR1 Antibody

상품 한눈에 보기

Human TBR1 단백질을 표적으로 하는 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 단백질 발현 비교 가능. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제됨. 인간, 생쥐, 랫트에서 100% 반응 확인. PBS/glycerol buffer에 보존됨.

카탈로그번호: HPA078657-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA078657-100 Anti-TBR1 Antibody, T-box, brain 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA078657-25 Anti-TBR1 Antibody, T-box, brain 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TBR1 Antibody

Anti-TBR1 Antibody

Target Information

Target Protein: T-box, brain 1
Target Gene: TBR1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD

Product Description

Polyclonal antibody against Human TBR1.

Open Datasheet

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000035033	100%
Rat	ENSRNOG00000005049	100%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand