Atlas Antibodies Anti-TAB3 Antibody
Human TAB3 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 응용에 적합하며, 높은 종간 보존성(마우스/랫 98%)을 보임. 40% 글리세롤 및 PBS 완충액에 보존제 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TAB3 Antibody
Target: TGF-beta activated kinase 1/MAP3K7 binding protein 3
Supplier: Atlas Antibodies
Catalog No.: HPA034980
Product Description
Polyclonal antibody against Human TAB3, also known as MAP3K7IP3.
Recommended for applications such as immunohistochemistry (IHC).
Alternative Gene Names: MAP3K7IP3
Target Gene: TAB3
Target Protein: TGF-beta activated kinase 1/MAP3K7 binding protein 3
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
QPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYA
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000035476): 98%
- Rat (ENSRNOG00000003643): 98%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Preservative | Sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|